PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna31098.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 320aa    MW: 36116.9 Da    PI: 7.1174
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna31098.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.7e-182167248
                             SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             + W +eEd++l+++v+ +G g+W+t++++ g++R++k+c++rw +yl
  mrna31098.1-v1.0-hybrid 21 NLWKPEEDLILKKYVETHGEGNWATVSKRSGLNRSGKSCRLRWKNYL 67
                             56*******************************************97 PP

2Myb_DNA-binding53.55.6e-1773118148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg +++eE++l+++ +k+lG++ W++Ia +++ gRt++++k++w+++l
  mrna31098.1-v1.0-hybrid  73 RGDMSEEEEDLIIRMHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 118
                              7899******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0391567IPR017930Myb domain
SMARTSM007176.8E-161969IPR001005SANT/Myb domain
SuperFamilySSF466891.28E-2819114IPR009057Homeodomain-like
PfamPF002493.4E-162167IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-222274IPR009057Homeodomain-like
CDDcd001671.24E-112367No hitNo description
PROSITE profilePS5129425.02468122IPR017930Myb domain
SMARTSM007175.1E-1772120IPR001005SANT/Myb domain
PfamPF002492.0E-1573118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2375121IPR009057Homeodomain-like
CDDcd001675.68E-1276118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010026Biological Processtrichome differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MENKRVKALQ QEQHSSWNKK NLWKPEEDLI LKKYVETHGE GNWATVSKRS GLNRSGKSCR  60
LRWKNYLRPN IKRGDMSEEE EDLIIRMHKL LGNRWSLIAG RLPGRTDNEV KNYWNTHLNK  120
NNTGCCPAPE SGGLSGRKRK TNNHDNYSDN THKHQDNCRC SNKTRKTIGG TESTKTESMT  180
REEELKDGIN SKEDDPSTST ITSTMTATSY PYWMGDYTSN TDQSLNFDYA DIDHQYSPSS  240
SWIQCCLPTI TGNIATSSST FAFDDEPFFA HMDSFLLLEA AFGCTTAAAA ATEGMQSSAT  300
MPFSSADDPH SPHYQLFHK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-22201204103C-Myb DNA-Binding Domain
1msf_C1e-22201204103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004288785.10.0PREDICTED: trichome differentiation protein GL1-like
TrEMBLW9SZ253e-72W9SZ25_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF135452026
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52600.13e-64myb domain protein 82